Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPRR3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SPRR3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15767920
View Documents
Novus Biologicals
NBP15767920UL
20 μL
Each for $152.22
Add to cart
 
NBP157679
View Documents
Novus Biologicals
NBP157679
100 μL
Each for $436.00
Add to cart
 
Description

Description

SPRR3 Polyclonal specifically detects SPRR3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SPRR3
Polyclonal
Rabbit
Cancer
22 kDa pancornulin, Cornifin beta, Esophagin, small proline-rich protein 3, SPRC
SPRR3
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q9UBC9
6707
Synthetic peptides corresponding to SPRR3(small proline-rich protein 3) The peptide sequence was selected from the middle region of SPRR3. Peptide sequence DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit