Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPRR3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | SPRR3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15767920
|
Novus Biologicals
NBP15767920UL |
20 μL |
Each for $152.22
|
|
NBP157679
|
Novus Biologicals
NBP157679 |
100 μL |
Each for $436.00
|
|
Description
SPRR3 Polyclonal specifically detects SPRR3 in Human samples. It is validated for Western Blot.Specifications
SPRR3 | |
Polyclonal | |
Rabbit | |
Cancer | |
22 kDa pancornulin, Cornifin beta, Esophagin, small proline-rich protein 3, SPRC | |
SPRR3 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9UBC9 | |
6707 | |
Synthetic peptides corresponding to SPRR3(small proline-rich protein 3) The peptide sequence was selected from the middle region of SPRR3. Peptide sequence DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title