Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPRTN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP184163
Description
SPRTN Polyclonal specifically detects SPRTN in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| C1orf124 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml | |
| C1orf124, chromosome 1 open reading frame 124, DDDL1880, dJ876B10.3, DKFZP547N043, PRO4323, RP5-876B10.3, Spartan, SprT-like N-terminal domain, zinc finger RAD18 domain-containing protein C1orf124 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 83932 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SPRTN | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction