Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPRYD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17427020UL
Description
SPRYD3 Polyclonal specifically detects SPRYD3 in Human samples. It is validated for Western Blot.Specifications
SPRYD3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8NCJ5 | |
SPRYD3 | |
Synthetic peptides corresponding to the N terminal of SPRYD3. Immunizing peptide sequence LVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGDRIGC. | |
Affinity Purified | |
RUO | |
84926 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ14800, SPRY domain containing 3, SPRY domain-containing protein 3 | |
Rabbit | |
50 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title