Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SPRYD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen SPRYD3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17427020
View Documents
Novus Biologicals
NBP17427020UL
20 μL
Each for $152.22
Add to cart
 
NBP174270
View Documents
Novus Biologicals
NBP174270
100 μL
Each for $436.00
Add to cart
 
Description

Description

SPRYD3 Polyclonal specifically detects SPRYD3 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SPRYD3
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
FLJ14800, SPRY domain containing 3, SPRY domain-containing protein 3
SPRYD3
IgG
Affinity Purified
50 kDa
Western Blot
Unconjugated
RUO
Q8NCJ5
84926
Synthetic peptides corresponding to the N terminal of SPRYD3. Immunizing peptide sequence LVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGDRIGC.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit