Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SPRYD3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | SPRYD3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17427020
|
Novus Biologicals
NBP17427020UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP174270
|
Novus Biologicals
NBP174270 |
100 μL |
Each for $482.50
|
|
|||||
Description
SPRYD3 Polyclonal specifically detects SPRYD3 in Human samples. It is validated for Western Blot.Specifications
| SPRYD3 | |
| Polyclonal | |
| Rabbit | |
| Q8NCJ5 | |
| 84926 | |
| Synthetic peptides corresponding to the N terminal of SPRYD3. Immunizing peptide sequence LVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGDRIGC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ14800, SPRY domain containing 3, SPRY domain-containing protein 3 | |
| SPRYD3 | |
| IgG | |
| 50 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title