Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SR140 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SR140 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170713
|
Novus Biologicals
NBP170713 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SR140 Polyclonal specifically detects SR140 in Human samples. It is validated for Western Blot.Specifications
| SR140 | |
| Polyclonal | |
| Rabbit | |
| 140 kDa Ser/Arg-rich domain protein, fSAPa, KIAA0332, SR140, U2 snRNP-associated SURP domain containing, U2 snRNP-associated SURP motif-containing protein, U2-associated protein SR140 | |
| U2SURP | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 23350 | |
| Synthetic peptides corresponding to SR140(U2-associated SR140 protein) The peptide sequence was selected from the N terminal of SR140. Peptide sequence NLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title