SRD5A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159525

Catalog No. NBP159525

Description

SRD5A2 Polyclonal specifically detects SRD5A2 in Human, Monkey samples. It is validated for Western Blot.

Specifications

• Antigen: SRD5A2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3-oxo-5-alpha-steroid 4-dehydrogenase 2,5 alpha-SR2, EC 1.3.99.5, MGC138457, S5AR 2, SR type 2, Steroid 5-alpha-reductase 2,3-oxo-5 alpha-steroid 4-dehydrogenase 2, steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 2), Type II 5-alpha reductase
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%.
• Target Species: Human, Monkey, Rat, Porcine, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P31213
• Gene Symbols: SRD5A2
• Immunogen: Synthetic peptides corresponding to SRD5A2 (steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2)) The peptide sequence was selected from the N terminal of SRD5A2)(50ug). Peptide sequence KHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSLFGPPGTVLL The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 6716
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.