Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SSBP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | SSBP2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml, Immunohistochemistry |
| Applications | Western Blot, Immunohistochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SSBP2 Polyclonal specifically detects SSBP2 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| SSBP2 | |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| Rabbit | |
| Human | |
| DKFZp686F03273, HSPC116, Sequence-specific single-stranded-DNA-binding protein 2, single-stranded DNA binding protein 2, single-stranded DNA-binding protein 2, SOSS-B2, SSDP2 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human SSBP2 (NP_036578). Peptide sequence YPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTP | |
| Affinity purified |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 23635 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title