Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SSX7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17946820UL
Description
SSX7 Polyclonal specifically detects SSX7 in Human samples. It is validated for Western Blot.Specifications
SSX7 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_775494 | |
SSX7 | |
Synthetic peptide directed towards the middle region of human SSX7The immunogen for this antibody is SSX7. Peptide sequence IFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPSTSEKINKTSG. | |
Affinity Purified | |
RUO | |
280658 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
protein SSX7, synovial sarcoma, X breakpoint 7 | |
Rabbit | |
21 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction