ST3GAL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162481

Catalog No. NBP162481

Description

ST3GAL4 Polyclonal specifically detects ST3GAL4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ST3GAL4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6IBE6
• Gene Symbols: ST3GAL4
• Immunogen: Synthetic peptides corresponding to ST3GAL4(ST3 beta-galactoside alpha-2,3-sialyltransferase 4) The peptide sequence was selected from the middle region of ST3GAL4. Peptide sequence IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6484
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Alpha 2,3-sialyltransferase IV, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, CGS23FLJ46764, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.9, FLJ11867, gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, NANTA3alpha-3-N-acetylneuraminyltransferase, SAT3, SAT-3, Sialyltransferase 4C, sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase), SIAT4-C, SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, ST3 beta-galactoside alpha-2,3-sialyltransferase 4, ST3Gal IV, ST3GalA.2, ST3GalIV, ST-4, STZSIAT4
• Host Species: Rabbit
• Molecular Weight of Antigen: 37 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.