Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ST3GAL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16248120UL
Description
ST3GAL4 Polyclonal specifically detects ST3GAL4 in Human samples. It is validated for Western Blot.Specifications
ST3GAL4 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q6IBE6 | |
ST3GAL4 | |
Synthetic peptides corresponding to ST3GAL4(ST3 beta-galactoside alpha-2,3-sialyltransferase 4) The peptide sequence was selected from the middle region of ST3GAL4. Peptide sequence IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM. | |
Affinity Purified | |
RUO | |
6484 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Alpha 2,3-sialyltransferase IV, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, CGS23FLJ46764, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.9, FLJ11867, gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, NANTA3alpha-3-N-acetylneuraminyltransferase, SAT3, SAT-3, Sialyltransferase 4C, sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase), SIAT4-C, SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, ST3 beta-galactoside alpha-2,3-sialyltransferase 4, ST3Gal IV, ST3GalA.2, ST3GalIV, ST-4, STZSIAT4 | |
Rabbit | |
37 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction