Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ST3GAL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen ST3GAL4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1624820
View Documents
Novus Biologicals
NBP16248120UL
20 μL
Each for $152.22
Add to cart
 
NBP162481
View Documents
Novus Biologicals
NBP162481
100 μL
Each for $436.00
Add to cart
 
Description

Description

ST3GAL4 Polyclonal specifically detects ST3GAL4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ST3GAL4
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
Alpha 2,3-sialyltransferase IV, Alpha 2,3-ST 4, Beta-galactoside alpha-2,3-sialyltransferase 4, CGS23FLJ46764, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.9, FLJ11867, gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase, Gal-NAc6S, NANTA3alpha-3-N-acetylneuraminyltransferase, SAT3, SAT-3, Sialyltransferase 4C, sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase), sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase), SIAT4-C, SIAT4CCMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4, ST3 beta-galactoside alpha-2,3-sialyltransferase 4, ST3Gal IV, ST3GalA.2, ST3GalIV, ST-4, STZSIAT4
ST3GAL4
IgG
Affinity Purified
37 kDa
Western Blot
Unconjugated
RUO
Q6IBE6
6484
Synthetic peptides corresponding to ST3GAL4(ST3 beta-galactoside alpha-2,3-sialyltransferase 4) The peptide sequence was selected from the middle region of ST3GAL4. Peptide sequence IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit