ST6 Sialyltransferase 6/ST6GALNAC6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309229100UL

Catalog No. NB123359

Description

ST6 Sialyltransferase 6/ST6GALNAC6 Polyclonal specifically detects ST6 Sialyltransferase 6/ST6GALNAC6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ST6 Sialyltransferase 6/ST6GALNAC6
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI, EC 2.4.99, EC 2.4.99.-, EC 2.4.99.7, GalNAc alpha-2,6-sialyltransferase VI, hST6GalNAc VI, RP11-203J24.3, Sialyltransferase 7F, sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialytransferase) F, SIAT7F, SIAT7-F, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 6, ST6GalNAc VI, ST6GalNAcVI
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ST6 Sialyltransferase 6/ST6GALNAC6 (NP_038471). Peptide sequence ALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKT
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 30815
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.