ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325159

Catalog No. NB301293

Description

ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 Polyclonal antibody specifically detects ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: Alpha-2,8-sialyltransferase 8D, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase, CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase, EC 2.4.99, EC 2.4.99.-, Polysialyltransferase-1, PST1MGC61459, PSTMGC34450, sialyltransferase 8 (alpha-2, 8-polysialytransferase) D, Sialyltransferase 8D, Sialytransferase St8Sia IV, SIAT8D, SIAT8-D, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4, ST8SiaIV, ST8SIA-IV
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein ST8 alpha-2,8-Sialyltransferase 4/ST8SIA4 using the following amino acid sequence: PSVVQRAFGGFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNAL
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 7903
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified