Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB126079
|
Novus Biologicals
NBP310589100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Polyclonal specifically detects ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 in Human samples. It is validated for Western Blot.Specifications
| ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Stem Cell Markers | |
| PBS buffer, 2% sucrose | |
| 6489 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Alpha-2,8-sialyltransferase 8A, alpha-N-acetylneuraminide alpha-2,8-sialyltransferase, disialoganglioside (GD3) synthase, Ganglioside GD3 synthase, Ganglioside GT3 synthase, ganglioside-specific alpha-2,8-polysialyltransferase, GD3 synthase), GD3S, sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3synthase) A, Sialyltransferase 8A, sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, Sialytransferase St8Sia I, SIAT8A, SIAT8-A, SIAT8EC 2.4.99.8, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1, ST8SiaI | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 (NP_001291379.1). Peptide sequence GSFYTHSPLTIQLTLSSHRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQR | |
| Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title