Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Polyclonal antibody specifically detects ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 in Human samples. It is validated for ImmunofluorescenceSpecifications
ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Neuroscience | |
PBS, pH 7.2, 40% glycerol | |
8128 | |
IgG | |
Affinity purified |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Human | |
alpha-2,8-sialyltransferase 8B, alpha-2,8-sialyltransferase 8B 1, EC 2.4.99, EC 2.4.99.-, HsT19690, MGC116854, MGC116857, sialyltransferase 8 (alpha-2, 8-sialytransferase) B, Sialyltransferase 8B, Sialyltransferase X, Sialytransferase St8Sia II, SIAT8B, SIAT8-B, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, ST8SIA-II, STXST8SiaII | |
This antibody was developed against Recombinant Protein corresponding to amino acids: EEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSSPAVVDRSNESIKHNIQPASSKWRHNQTLSLRIRKQI | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title