Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STAC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen STAC2
Dilution Western Blot 1.0 ug/ml, Immunoprecipitation
Applications Western Blot, Immunoprecipitation
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB124239
View Documents
Novus Biologicals
NBP309669100UL
100 μg
Each for $352.89
Add to cart
 
NB124240
View Documents
Novus Biologicals
NBP30966925UL
25 μg
Each for $106.19
Add to cart
 
Description

Description

STAC2 Polyclonal antibody specifically detects STAC2 in Human samples. It is validated for Western Blot, Immunoprecipitation
Specifications

Specifications

STAC2
Western Blot, Immunoprecipitation
Purified
RUO
PBS buffer, 2% sucrose
342667
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Immunoprecipitation
Unconjugated
Rabbit
Human
24b2/STAC2, MGC129694, SH3 and cysteine rich domain 2,24b2, SH3 and cysteine-rich domain-containing protein 2, Src homology 3 and cysteine-rich domain-containing protein 2
The immunogen is a synthetic peptide directed towards the N-terminal region of Human STAC2 (NP_945344). Peptide sequence TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit