Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STAM2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | STAM2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB124891
|
Novus Biologicals
NBP309995100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
STAM2 Polyclonal specifically detects STAM2 in Mouse samples. It is validated for Western Blot.Specifications
| STAM2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| DKFZp564C047, HBP, Hrs-binding protein, HSE1 homolog, signal transducing adapter molecule 2, signal transducing adaptor molecule (SH3 domain and ITAM motif) 2, STAM-2, STAM2A, STAM2B, STAM-like protein containing SH3 and ITAM domains 2 | |
| The immunogen is a synthetic peptide directed towards the middle region of mouse STAM2 (NP_005834.4). Peptide sequence QFSLISATIKSMKEEGITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAI | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 10254 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title