Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STAMP2/STEAP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310071100UL
Description
STAMP2/STEAP4 Polyclonal specifically detects STAMP2/STEAP4 in Human samples. It is validated for Western Blot.Specifications
STAMP2/STEAP4 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
EC 1.16.1, EC 1.16.1.-, FLJ23153, Six-transmembrane epithelial antigen of prostate 4, SixTransMembrane protein of prostate 2, STAMP2DKFZp666D049, STEAP family member 4, TIARPsix transmembrane prostate protein 2, TNFAIP9, Tumor necrosis factor, alpha-induced protein 9metalloreductase STEAP4, tumor necrosis-alpha-induced adipose-related protein | |
The immunogen is a synthetic peptide directed towards the C terminal region of human STAMP2/STEAP4 (NP_001192244.1). Peptide sequence SNLRWYLPAAYVLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
79689 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction