Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STK38 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00


Antigen STK38
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
20 μL
Each for $152.22
Add to cart
View Documents
Novus Biologicals
100 μL
Each for $436.00
Add to cart


STK38 Polyclonal specifically detects STK38 in Human samples. It is validated for Western Blot.


Protein Kinase
Synthetic peptides corresponding to STK38(serine/threonine kinase 38) The peptide sequence was selected from the C terminal of STK38. Peptide sequence IGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESD.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
PBS and 2% Sucrose with 0.09% Sodium Azide
EC 2.7.11, EC, Ndr Ser/Thr kinase-like protein, NDR1, NDR1 protein kinase, NDRnuclear Dbf2-related 1, Nuclear Dbf2-related kinase 1, serine threonine protein kinase, serine/threonine kinase 38, serine/threonine-protein kinase 38
Affinity Purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit