Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STK38L Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | STK38L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157030
|
Novus Biologicals
NBP157030 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
STK38L Polyclonal specifically detects STK38L in Human samples. It is validated for Western Blot.Specifications
| STK38L | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| Q9Y2H1 | |
| 23012 | |
| Synthetic peptides corresponding to STK38L (serine/threonine kinase 38 like) The peptide sequence was selected from the middle region of STK38L. Peptide sequence PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.7.11, EC 2.7.11.1, KIAA0965nuclear Dbf2-related 2, NDR2 protein kinase, NDR2serine/threonine-protein kinase 38-like, Nuclear Dbf2-related kinase 2, serine/threonine kinase 38 like | |
| STK38L | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title