Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
STRA6 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$152.22 - $436.00
Specifications
Antigen | STRA6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159720UL
|
Novus Biologicals
NBP15971120UL |
20 μL |
Each for $152.22
|
|
NBP159711
|
Novus Biologicals
NBP159711 |
100 μL |
Each for $436.00
|
|
Description
STRA6 Polyclonal specifically detects STRA6 in Human samples. It is validated for Western Blot.Specifications
STRA6 | |
Polyclonal | |
Rabbit | |
Human | |
Q9BX79 | |
64220 | |
Synthetic peptides corresponding to STRA6(stimulated by retinoic acid gene 6 homolog (mouse)) The peptide sequence was selected from the N terminal of STRA6 (NP_071764). Peptide sequence MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
FLJ12541, MCOPS9, stimulated by retinoic acid gene 6 homolog (mouse), stimulated by retinoic acid gene 6 protein homolog | |
STRA6 | |
IgG | |
Affinity Purified | |
73 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title