Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

STYXL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $349.40

Specifications

Antigen STYXL1
Immunogen Synthetic peptide directed towards the middle region of human STYXL1The immunogen for this antibody is STYXL1. Peptide sequence FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17981420
View Documents
Novus Biologicals
NBP17981420UL
20ul
Each for $152.22
Add to cart
 
NBP179814
View Documents
Novus Biologicals
NBP179814
100 ul
Each for $349.40
Add to cart
 
Description

Description

STYXL1 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

STYXL1
Rabbit
Polyclonal
Unconjugated
51657
Affinity Purified
Western Blot
RUO
Synthetic peptide directed towards the middle region of human STYXL1The immunogen for this antibody is STYXL1. Peptide sequence FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA.
Primary
IgG
dual specificity phosphatase 24 (putative), Dual specificity phosphatase inhibitor MK-STYX, Dual specificity protein phosphatase 24, DUSP24, Map kinase phosphatase-like protein MK-STYX, MKSTYX, MK-STYX, serine/threonine/tyrosine interacting-like 1, serine/threonine/tyrosine-interacting-like protein 1
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
SDS
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit