SUNC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155413

Catalog No. NBP155413

Description

SUNC1 Polyclonal specifically detects SUNC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SUNC1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TAQ9
• Gene Symbols: SUN3
• Immunogen: Synthetic peptides corresponding to SUNC1(Sad1 and UNC84 domain containing 1) The peptide sequence was selected from the C terminal of SUNC1. Peptide sequence IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 256979
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC33329, Sad1 and UNC84 domain containing 1, Sad1 and UNC84 domain containing 3, Sad1/unc-84 domain-containing protein 1, SUN domain-containing protein 3, SUNC1
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.