Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SUNC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SUNC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP155413
|
Novus Biologicals
NBP155413 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SUNC1 Polyclonal specifically detects SUNC1 in Human samples. It is validated for Western Blot.Specifications
| SUNC1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| MGC33329, Sad1 and UNC84 domain containing 1, Sad1 and UNC84 domain containing 3, Sad1/unc-84 domain-containing protein 1, SUN domain-containing protein 3, SUNC1 | |
| SUN3 | |
| IgG | |
| Affinity Purified | |
| 40 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TAQ9 | |
| 256979 | |
| Synthetic peptides corresponding to SUNC1(Sad1 and UNC84 domain containing 1) The peptide sequence was selected from the C terminal of SUNC1. Peptide sequence IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title