Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SUR2A Mouse anti-Mouse, Rat, Clone: S319A-14, Invitrogen™

Mouse Monoclonal Antibody

Manufacturer:  Invitrogen MA527637

Catalog No. PIMA527637


Add to cart

Description

Description

Sulfonylurea receptors (SUR) are membrane proteins which are the molecular targets of the sulfonylurea class of anti-diabetic drugs whose mechanism of action is to promote insulin release from pancreatic beta cells. More specifically, SUR proteins are subunits of the inward-rectifier potassium ion channels Kir6.x (6.1 and 6.2). The association of four Kir6.x and four SUR subunits form an ion conducting channel commonly referred to as the KATP channel. The primary function of the sulfonylurea receptor is to sense intracellular levels of the nucleotides ATP and ADP and in response facilitate the open or closing its associated Kir6.x potassium channel. Hence the KATP channel monitors the energy balance within the cell.
Specifications

Specifications

SUR2A
Monoclonal
1 mg/ml
PBS with 50% glycerol and 0.09% sodium azide; pH 7.4
P70170, Q63563
ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A
Mouse
IgG2A
100 μg
-20°C
Primary
20928, 25560
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
S319A-14
Unconjugated
Abcc9
Liquid
Abcc9
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Protein G
RUO
Antibody
Monoclonal
Mouse, Rat
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit