Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SUSD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen SUSD4
Immunogen Synthetic peptides corresponding to SUSD4(sushi domain containing 4) The peptide sequence was selected from the N terminal of SUSD4. Peptide sequence MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15997420 View Documents Novus BiologicalsSupplier Diversity Partner
NBP15997420UL
20ul Each for $149.00
Add to cart
 
NBP159974 View Documents Novus BiologicalsSupplier Diversity Partner
NBP159974
100 ul Each for $329.00
Add to cart
 
Description

Description

SUSD4 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

SUSD4
Rabbit
Polyclonal
Unconjugated
55061
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to SUSD4(sushi domain containing 4) The peptide sequence was selected from the N terminal of SUSD4. Peptide sequence MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG.
Primary
IgG
FLJ10052, PRO222, sushi domain containing 4, sushi domain-containing protein 4, YHGM196
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit