Synaptophysin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159660

Catalog No. NBP159660

Description

Synaptophysin Polyclonal specifically detects Synaptophysin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Synaptophysin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Major synaptic vesicle protein p38, MRX, MRXSYP, synaptophysin
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Research Discipline: Angiogenesis, Membrane Vesicle Markers, Neuronal Cell Markers, Neuroscience, Neurotransmission, Stem Cell Markers
• Gene ID (Entrez): 6855
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 10-20 ug/ml, Immunohistochemistry-Paraffin 10-20 ug/ml
• Gene Accession No.: B2R7L6
• Gene Symbols: SYP
• Immunogen: Synthetic peptides corresponding to SYP(synaptophysin) The peptide sequence was selected from the N terminal of SYP. Peptide sequence: MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.