Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Synaptophysin Rabbit anti-Human, Mouse, Rat, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$149.00 - $329.00
Specifications
| Antigen | Synaptophysin |
|---|---|
| Immunogen | Synthetic peptides corresponding to SYP(synaptophysin) The peptide sequence was selected from the N terminal of SYP. Peptide sequence MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
| NBP15966020 |
Novus Biologicals
NBP15966020UL |
20ul |
Each for $149.00
|
|
NBP159660 |
Novus Biologicals
NBP159660 |
100 ul |
Each for $329.00
|
|
Description
Synaptophysin Polyclonal antibody specifically detects Antigen in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blotting.Specifications
| Synaptophysin | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 6855 | |
| Affinity Purified | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| RUO |
| Synthetic peptides corresponding to SYP(synaptophysin) The peptide sequence was selected from the N terminal of SYP. Peptide sequence MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE. | |
| Primary | |
| IgG | |
| Major synaptic vesicle protein p38, MRX, MRXSYP, synaptophysin | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title