Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Synaptotagmin 1 Antibody, Novus Biologicals™

Name: Synaptotagmin 1 Antibody, Novus Biologicals&trade;
Brand: Novus Biologicals
SKU: NBP19149920
Price: 204.00 USD

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP19149920UL

View more versions of this product

Catalog No. NBP19149920

$204.00 / Each of 1

Qty

Add to Cart

Description

Synaptotagmin 1 Polyclonal specifically detects Synaptotagmin 1 in Mouse, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	Synaptotagmin-1
Classification	Polyclonal
Dilution	Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:2000
Gene Accession No.	NP_033332
Gene Symbols	SYT1
Immunogen	Synthetic peptide directed towards the middle region of human Syt1. Peptide sequence FDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSL.
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	6857
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	DKFZp781D2042, p65, SVP65, synaptotagmin Isynaptotagmin 1, synaptotagmin-1, SYT, SytI
Host Species	Rabbit
Molecular Weight of Antigen	47 kDa
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Mouse, Bovine
Isotype	IgG

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

Synaptotagmin 1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions