Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SYT11 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169190

 View more versions of this product

Catalog No. NBP169190


Add to cart

Description

Description

SYT11 Polyclonal specifically detects SYT11 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SYT11
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
DKFZp781D015, KIAA0080synaptotagmin 12, MGC10881, MGC17226, synaptotagmin XISYT12, synaptotagmin-11, SytXI
Rabbit
48 kDa
100 μL
Neuronal Cell Markers, Neurotransmission
23208
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
Q9BT88
SYT11
Synthetic peptides corresponding to SYT11 (synaptotagmin XI) The peptide sequence was selected from the N terminal of SYT11. Peptide sequence AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS.
Affinity purified
RUO
Primary
Pig: 86%.
Human, Mouse, Guinea Pig
IgG
Product Suggestions

Product Suggestions

SDS
missing translation for 'documents'

missing translation for 'documents'

Product Certifications
Promotions

Promotions

missing translation for 'provideContentCorrection'

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

missing translation for 'productTitle'