SYT11 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169190

Catalog No. NBP169190

Description

SYT11 Polyclonal specifically detects SYT11 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SYT11
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BT88
• Gene Symbols: SYT11
• Immunogen: Synthetic peptides corresponding to SYT11 (synaptotagmin XI) The peptide sequence was selected from the N terminal of SYT11. Peptide sequence AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Pig: 86%.
• Target Species: Human, Mouse, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp781D015, KIAA0080synaptotagmin 12, MGC10881, MGC17226, synaptotagmin XISYT12, synaptotagmin-11, SytXI
• Host Species: Rabbit
• Molecular Weight of Antigen: 48 kDa
• Quantity: 100 μL
• Research Discipline: Neuronal Cell Markers, Neurotransmission
• Gene ID (Entrez): 23208
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.