Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SYT16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169188
Description
SYT16 Polyclonal specifically detects SYT16 in Human samples. It is validated for Western Blot.Specifications
SYT16 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
chr14 synaptotagmin, CHR14SYT, STREP14, Synaptotagmin 14-like protein, synaptotagmin XIV-like, Synaptotagmin XIV-related protein, synaptotagmin XVI, synaptotagmin-16, SYT14L, SYT14R, yt14r | |
Rabbit | |
72 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Dog: 86% pig 85 %. | |
Human, Rat, Canine, Equine, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q17RD7 | |
SYT16 | |
Synthetic peptides corresponding to SYT16 (synaptotagmin XVI) The peptide sequence was selected from the N terminal of SYT16. Peptide sequence DKLDQDLDNIQIQETYFEDEEQDNDWSQEDANSLFLEVDHFSCCNSDLQD. | |
Affinity purified | |
RUO | |
83851 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction