Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAAR4 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen TAAR4
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125182
View Documents
Novus Biologicals
NBP31014025UL
25 μg
Each for $106.19
Add to cart
 
NB125181
View Documents
Novus Biologicals
NBP310140100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

TAAR4 Polyclonal antibody specifically detects TAAR4 in Rat samples. It is validated for Western Blot
Specifications

Specifications

TAAR4
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
209513
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Rat
Gm226, Ta2, TAAR 4
The immunogen is a synthetic peptide directed towards the C terminal region of rat TAAR4 (NP_783173.1). Peptide sequence FLWLGYFNSTFNPIIYGMFYPWFRKALRMIVTGTIFRSDSSTSSLHPAHP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit