Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TACE/ADAM17 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258422

Catalog No. NBP258422


Add to cart

Description

Description

TACE/ADAM17 Polyclonal antibody specifically detects TACE/ADAM17 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

TACE/ADAM17
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
ADAM 17, ADAM metallopeptidase domain 17, ADAM metallopeptidase domain 18, ADAM18, CD156B, CD156b antigen, CSVP, disintegrin and metalloproteinase domain-containing protein 17, EC 3.4.24.86, MGC71942, Snake venom-like protease, TACEcSVP, TNF-alpha convertase, TNF-alpha converting enzyme, TNF-alpha-converting enzyme, tumor necrosis factor, alpha, converting enzyme
Rabbit
IgG
100 ul
Apoptosis, Myeloid derived Suppressor Cell, Stem Cell Signaling Pathway
Primary
6868
Human
Western Blot, Immunocytochemistry, Immunofluorescence
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
ADAM17
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
Affinity purified
RUO
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only