Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAF148 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen TAF148
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125762
View Documents
Novus Biologicals
NBP31043025UL
25 μg
Each for $106.19
Add to cart
 
NB125761
View Documents
Novus Biologicals
NBP310430100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

TAF148 Polyclonal antibody specifically detects TAF148 in Rat samples. It is validated for Western Blot
Specifications

Specifications

TAF148
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
9015
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Rat
RAFI48, SL1MGC:17061, TAFI48TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kD, TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa, TATA box-binding protein-associated factor 1A, TATA box-binding protein-associated factor RNA polymerase I subunit A, TBP-associated factor 1A, Transcription factor SL1,48kD subunit
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat TAF148 (NP_001032281). Peptide sequence FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit