Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAF1C Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP258841

Catalog No. NBP258841


Add to cart

Description

Description

TAF1C Polyclonal antibody specifically detects TAF1C in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

TAF1C
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
MGC:39976, RNA polymerase I-specific TBP-associated factor 110 kDa, SL1, 110kD subunit, SL1TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kD, TAFI110TBP-associated factor 1C, TAFI95, TATA box binding protein (TBP)-associated factor, RNA polymerase I, C, 110kDa, TATA box-binding protein-associated factor 1C, TATA box-binding protein-associated factor RNA polymerase I subunit C, transcription factor SL1, Transcription initiation factor SL1/TIF-IB subunit C
Rabbit
IgG
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Polyclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence
Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Affinity Purified
TAF1C
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FRDSSSWRWADFTAHPRVLTVGDRTGVKMLDTQGPPGCGLLLFRLGAEASCQKGERVLLTQYLGHSSPKCLPPTLHLVCTQFSLYLVDE
Affinity purified
RUO
Primary
9013
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only