Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAF6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31048525UL

 View more versions of this product

Catalog No. NB125872


Add to cart

Description

Description

TAF6 Polyclonal antibody specifically detects TAF6 in Human samples. It is validated for Western Blot, ChIP assay
Specifications

Specifications

TAF6
Unconjugated
PBS buffer, 2% sucrose
DKFZp781E21155, MGC:8964, RNA polymerase II, E, 70/85kD, TAF(II)70, TAF(II)80, TAF2ERNA polymerase II TBP-associated factor subunit E, TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa, TAFII70TAFII-80, TAFII80TAFII-70, TAFII85, Transcription initiation factor TFIID 70 kDa subunit, Transcription initiation factor TFIID 80 kDa subunit, transcription initiation factor TFIID subunit 6
The immunogen is a synthetic peptide directed towards the C terminal region of human TAF6 (NP_005632). Peptide sequence PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHP
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot, ChIP assay
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Purified
Rabbit
Affinity purified
RUO
Primary
6878
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit