Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAF6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen TAF6
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Applications Western Blot, ChIP assay
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB125872
View Documents
Novus Biologicals
NBP31048525UL
25 μg
Each for $106.19
Add to cart
 
NB125871
View Documents
Novus Biologicals
NBP310485100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

TAF6 Polyclonal antibody specifically detects TAF6 in Human samples. It is validated for Western Blot, ChIP assay
Specifications

Specifications

TAF6
Western Blot, ChIP assay
Purified
RUO
PBS buffer, 2% sucrose
6878
Polyclonal
Affinity purified
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Unconjugated
Rabbit
Human
DKFZp781E21155, MGC:8964, RNA polymerase II, E, 70/85kD, TAF(II)70, TAF(II)80, TAF2ERNA polymerase II TBP-associated factor subunit E, TAF6 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 80kDa, TAFII70TAFII-80, TAFII80TAFII-70, TAFII85, Transcription initiation factor TFIID 70 kDa subunit, Transcription initiation factor TFIID 80 kDa subunit, transcription initiation factor TFIID subunit 6
The immunogen is a synthetic peptide directed towards the C terminal region of human TAF6 (NP_005632). Peptide sequence PSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit