Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAF7L Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TAF7L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180292
|
Novus Biologicals
NBP180292 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TAF7L Polyclonal specifically detects TAF7L in Mouse samples. It is validated for Western Blot.Specifications
| TAF7L | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_083234 | |
| 54457 | |
| Synthetic peptide directed towards the middle region of mouse TAF7L. Peptide sequence EGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 50kDa, CT40FLJ23157, RNA polymerase II TBP-associated factor subunit Q, TAF2QRNA polymerase II, Q, TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, TATA box binding protein (TBP)-associated factor, RNA polymerase II, Q, TATA box-binding protein-associated factor 50 kDa, transcription initiation factor TFIID subunit 7-like | |
| TAF7L | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title