Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TAF7L Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Antigen TAF7L
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μL
Each of 1 for $436.00
Add to cart


TAF7L Polyclonal specifically detects TAF7L in Mouse samples. It is validated for Western Blot.


Synthetic peptide directed towards the middle region of mouse TAF7L. Peptide sequence EGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQ.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
PBS and 2% Sucrose with 0.09% Sodium Azide
50kDa, CT40FLJ23157, RNA polymerase II TBP-associated factor subunit Q, TAF2QRNA polymerase II, Q, TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, TATA box binding protein (TBP)-associated factor, RNA polymerase II, Q, TATA box-binding protein-associated factor 50 kDa, transcription initiation factor TFIID subunit 7-like
Protein A purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit