TAFA3/FAM19A3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159502

Catalog No. NBP159502

Description

TAFA3/FAM19A3 Polyclonal specifically detects TAFA3/FAM19A3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TAFA3/FAM19A3
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q2M1P9
• Gene Symbols: FAM19A3
• Immunogen: Synthetic peptides corresponding to FAM19A3(family with sequence similarity 19 (chemokine (C-C motif)-like), member A3) The peptide sequence was selected from the middle region of FAM19A3. Peptide sequence FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Equine: 92%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Chemokine-like protein TAFA-3, family with sequence similarity 19 (chemokine (C-C motif)-like), member A3, MGC138473, TAFA3, TAFA-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 284467
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.