Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TAL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TAL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180224
|
Novus Biologicals
NBP180224 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TAL2 Polyclonal specifically detects TAL2 in Mouse samples. It is validated for Western Blot.Specifications
| TAL2 | |
| Polyclonal | |
| Rabbit | |
| NP_033343 | |
| 6887 | |
| Synthetic peptide directed towards the middle region of human Tal2. Peptide sequence INFLVKVLGEQSLHQTGVAAQGNILGLFPPKTRLPDEDDRTLLNDYRVPS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| bHLHa19, Class A basic helix-loop-helix protein 19, TAL-2, T-cell acute lymphocytic leukemia 2, T-cell acute lymphocytic leukemia protein 2 | |
| TAL2 | |
| IgG | |
| Affinity Purified | |
| 12 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title