Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TARP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen TARP
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17408020
View Documents
Novus Biologicals
NBP17408020UL
20 μL
Each for $152.22
Add to cart
 
NBP174080
View Documents
Novus Biologicals
NBP174080
100 μL
Each for $436.00
Add to cart
 
Description

Description

TARP Polyclonal specifically detects TARP in Human samples. It is validated for Western Blot.
Specifications

Specifications

TARP
Polyclonal
Rabbit
Q0VGM3
445347
Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
CD3G, TARP TCR gamma alternate reading frame protein, TCRG, TCRGC1, TCRGC2
TARP
IgG
Affinity Purified
13 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit