Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TARP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | TARP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17408020
|
Novus Biologicals
NBP17408020UL |
20 μL |
Each for $152.22
|
|
NBP174080
|
Novus Biologicals
NBP174080 |
100 μL |
Each for $436.00
|
|
Description
TARP Polyclonal specifically detects TARP in Human samples. It is validated for Western Blot.Specifications
| TARP | |
| Polyclonal | |
| Rabbit | |
| Q0VGM3 | |
| 445347 | |
| Synthetic peptides corresponding to the N terminal of TARP. Immunizing peptide sequence YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CD3G, TARP TCR gamma alternate reading frame protein, TCRG, TCRGC1, TCRGC2 | |
| TARP | |
| IgG | |
| Affinity Purified | |
| 13 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title