Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TASP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TASP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156869
|
Novus Biologicals
NBP156869 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TASP1 Polyclonal specifically detects TASP1 in Human samples. It is validated for Western Blot.Specifications
| TASP1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C20orf13taspase 1, chromosome 20 open reading frame 13, dJ585I14.2, EC 3.4.25.-, FLJ20212, MGC39159, taspase, threonine aspartase, 1, Taspase-1, threonine aspartase 1 | |
| TASP1 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9H6P5 | |
| 55617 | |
| Synthetic peptides corresponding to TASP1(taspase, threonine aspartase, 1) The peptide sequence was selected from the middle region of TASP1. Peptide sequence QNKQTLLVEFLWSHTTESMCVGYMSAQDGKAKTHISRLPPGAVAGQSVAI. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title