Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TATA Element Modulatory Factor 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TATA Element Modulatory Factor 1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179708
|
Novus Biologicals
NBP179708 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TATA Element Modulatory Factor 1 Polyclonal specifically detects TATA Element Modulatory Factor 1 in Human samples. It is validated for Western Blot.Specifications
| TATA Element Modulatory Factor 1 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| TATA element modulatory factor 1 | |
| TMF1 | |
| IgG | |
| Affinity Purified | |
| 123 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_009045 | |
| 7110 | |
| Synthetic peptide directed towards the N terminal of human TMF1. Peptide sequence TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title