Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Tau tubulin kinase 2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Tau tubulin kinase 2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP182388
View Documents
Novus Biologicals
NBP182388
100 μL
Each for $436.00
Add to cart
 
NBP18238820
View Documents
Novus Biologicals
NBP18238820UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

Tau tubulin kinase 2 Polyclonal specifically detects Tau tubulin kinase 2 in Mouse samples. It is validated for Western Blot.
Specifications

Specifications

Tau tubulin kinase 2
Polyclonal
Rabbit
NP_001020027
146057
Synthetic peptide towards tau tubulin kinase 2. Peptide sequence KPDYQLLTSVFDNSIKTFGVIESDPFDWEKSGTDGSLTTTTTSATPQLHT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
EC 2.7.11, EC 2.7.11.1, KIAA0847tau-tubulin kinase 2, SCA11, spinocerebellar ataxia 11, tau tubulin kinase 2, TTBK
TTBK2
IgG
Affinity Purified
137 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit