Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TBPL2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TBPL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180268
|
Novus Biologicals
NBP180268 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TBPL2 Polyclonal specifically detects TBPL2 in Mouse samples. It is validated for Western Blot.Specifications
| TBPL2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_951014 | |
| 387332 | |
| Synthetic peptide directed towards the N terminal of mouse TRF3. Peptide sequence FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| TATA box-binding protein-like protein 2, TATA box binding protein like 2, TBP2, TRF3 | |
| TBPL2 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title