Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TBRG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP179855

 View more versions of this product

Catalog No. NBP179855


Add to cart

Description

Description

TBRG1 Polyclonal antibody specifically detects TBRG1 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

TBRG1
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
TBRG1
Synthetic peptide directed towards the N terminal of human TBRG1The immunogen for this antibody is TBRG1. Peptide sequence KARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLK.
29 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Expected identity based on immunogen sequence: Xenopus: 76% Zebrafish: 85%.
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:1000
NP_116200
FLJ14621, FLJ90113, MGC129890, NIAMFLJ25020, Nuclear interactor of ARF and Mdm2, TB-5, transforming growth factor beta regulator 1
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
84897
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit