TBRG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179855

Catalog No. NBP179855

Description

TBRG1 Polyclonal specifically detects TBRG1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TBRG1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ14621, FLJ90113, MGC129890, NIAMFLJ25020, Nuclear interactor of ARF and Mdm2, TB-5, transforming growth factor beta regulator 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 29 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 76% Zebrafish: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_116200
• Gene Symbols: TBRG1
• Immunogen: Synthetic peptide directed towards the N terminal of human TBRG1The immunogen for this antibody is TBRG1. Peptide sequence KARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84897
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.