Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TBX10 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen TBX10
Immunogen Synthetic peptides corresponding to Tbx10 (T-box 10) The peptide sequence was selected from the N terminal of Tbx10. Peptide sequence YAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNN.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16898220 View Documents Novus BiologicalsSupplier Diversity Partner
NBP16898220UL
20ul Each for $149.00
Add to cart
 
NBP168982 View Documents Novus BiologicalsSupplier Diversity Partner
NBP168982
100 ul Each for $329.00
Add to cart
 
Description

Description

TBX10 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

TBX10
Rabbit
Polyclonal
Unconjugated
347853
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to Tbx10 (T-box 10) The peptide sequence was selected from the N terminal of Tbx10. Peptide sequence YAFHSSAWLVAGKADPATPGRVHFHPDSPAKGAQWMRQIVSFDKLKLTNN.
Primary
IgG
T-box 10, T-box 7, T-box protein 10, T-box transcription factor TBX10, T-box-containing transcriptional activator, TBX13, TBX7
PBS & 2% Sucrose. with No Preservative
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit