Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCAP Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | TCAP |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156664
|
Novus Biologicals
NBP156664 |
100 μL |
Each for $436.00
|
|
NBP15666420
|
Novus Biologicals
NBP15666420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
TCAP Polyclonal specifically detects TCAP in Human samples. It is validated for Western Blot.Specifications
| TCAP | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 19 kDa sarcomeric protein, CMD1NTitin cap protein, LGMD2G, limb girdle muscular dystrophy 2G (autosomal recessive), T-cap, TELE, telethonin, titin-cap (telethonin) | |
| TCAP | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O15273 | |
| 8557 | |
| Synthetic peptides corresponding to TCAP(titin-cap (telethonin)) The peptide sequence was selected from the N terminal of TCAP. Peptide sequence CSLHEEDTQRHETYHQQGQCQVLVQRSPWLMMRMGILGRGLQEYQLPYQR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title