Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TCEANC2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | TCEANC2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179423
|
Novus Biologicals
NBP179423 |
100 μL |
Each of 1 for $436.00
|
|
Description
TCEANC2 Polyclonal specifically detects TCEANC2 in Human samples. It is validated for Western Blot.Specifications
TCEANC2 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C1orf83, chromosome 1 open reading frame 83, FLJ32112, FLJ39169, RP4-758J24.3, transcription elongation factor A (SII) N-terminal and central domaincontaining 2 | |
TCEANC2 | |
IgG | |
Affinity Purified | |
24 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_694580 | |
127428 | |
Synthetic peptide directed towards the N terminal of human C1orf83. Peptide sequence MDKFVIRTPRIQNSPQKKDSGGKVYKQATIESLKRVVVVEDIKRWKTMLE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title